PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013611366.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 335aa    MW: 37408.5 Da    PI: 5.9944
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013611366.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.41.2e-3871061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +C+aCk+lrrkC+++Cv+ap+fp +qp+kf +vhk FGasnv kll++lp ++reda++slvyeAe r+++PvyG+vg+i+  qq+l+q + +++
  XP_013611366.1   7 PCSACKFLRRKCTRECVFAPHFPPDQPNKFSCVHKAFGASNVAKLLSELPLNQREDAVTSLVYEAETRIQEPVYGCVGLISLQQQRLKQIQRDTD 101
                     7*******************************************************************************************999 PP

          DUF260  96 llkee 100
                     ++++e
  XP_013611366.1 102 VARRE 106
                     88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5856107IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-387104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MASSNSPCSA CKFLRRKCTR ECVFAPHFPP DQPNKFSCVH KAFGASNVAK LLSELPLNQR  60
EDAVTSLVYE AETRIQEPVY GCVGLISLQQ QRLKQIQRDT DVARRELATY IGPEAMFPIL  120
QPQQPHFMPQ SQTQQPQFVP ETLQTVFMPQ TQETHFTPQT HQTQFIPQTQ KFMPETQQPS  180
SSSSVSAELT QQQHHDPSMM VIPTAQLYHL QQQQQFFEFQ QPEAVAGEQH SEMLRAYGEG  240
GSSSSHQHHQ NQPQAHVLRF NDGFDSVPTG SVTSTGFNQL TPSGTTVTGV SHSLALGGGT  300
YDIEARLFMP TQSSQQRPLQ TQETQTSSES DEEGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013611366.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-98LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0D3E2L00.0A0A0D3E2L0_BRAOL; Uncharacterized protein
STRINGBra037142.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2654433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-88ASYMMETRIC LEAVES 2-like 1